| Catalog# |
CF29 |
| Source |
E.coli |
| Description |
Recombinant Human Signal Transducer and Activator of Transcription 3/STAT3 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Asn175) of Human STAT3 fused with a 6His tag at the C-terminus. |
| Names |
Signal Transducer and Activator of Transcription 3, Acute-Phase Response Factor, STAT3, APRF |
| Accession # |
P40763 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEID QQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQAN HPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNLEHHHHHH
|
| Background |
Signal Transducer and Activator of Transcription 3 (STAT3) belongs to the transcription factor STAT family. STAT3 contains one SH2 domain and is a transcription factor expressed in most cell types. STAT3 is activated by multiple cytokines and growth factors including: IFN-a, IL-10, IL-6, IL-11, IL-12, IL-2, EGF etc. STAT3 functions as signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF and other growth factors. In addition, STAT3 may also mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. |
