| Catalog# |
CH11 |
| Source |
E.coli |
| Description |
Recombinant Human Small Ubiquitin-Related Modifier 3/SUMO3 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Phe103) of Human SUMO3. |
| Names |
Small Ubiquitin-Related Modifier 3, SUMO-3, SMT3 Homolog 1, SUMO-2, Ubiquitin-Like Protein SMT3B, Smt3B, SUMO3, SMT3B, SMT3H1 |
| Accession # |
P55854 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQP INETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
|
| Background |
SUMO3 belongs to the SUMO protein family and operates like ubiquitin. Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polyer. Nevertheless unlike ubiquitin that targets proteins for degration, SUMO3 takes part in several cellular processess, such as nuclear transport, transcription regulation, apoptosis and protein stability. SUMO3 participates in amyloid beta generation and has a key role in the oneset or progression of Alzheimer's disease. |
