| Catalog# |
CD34 |
| Source |
Human Cells |
| Description |
Recombinant Human Transmembrane and immunoglobulin domain-containing protein 2/TMIGD2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu23-Gly150) of Human TMIGD2 fused with a polyhistidine tag at the C-terminus. |
| Names |
Transmembrane and immunoglobulin domain-containing protein 2, Immunoglobulin and proline-rich receptor 1, IGPR1, TMIGD2 |
| Accession # |
Q96BF3 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH 7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRL SWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPGVD HHHHHH
|
| Background |
TMIGD2 is a single-pass type I membrane protein, which contains one Ig-like (immunoglobulin-like) domain. It is widely expressed in many tissues, such as epithelial, endothelial cells and lung. However, it isn’t detected in thyroid, cerebellum, thymus and cerebral cortex. TMIGD2 can form homophilic interactions that could regulate cell-cell interaction. It Interacts with CACNB2, DST, MIA and NCKIPSD. It is shown that TMIGD2 plays a role in cell-cell interaction, cell migration, and angiogenesis. |
