| Catalog# |
C011 |
| Source |
E.coli |
| Description |
Recombinant Human CD40 Ligand/CD40LG is produced by our E. coli expression system. The target protein is expressed with sequence (Met113-Leu261) of Human CD40LG. |
| Names |
CD40 Ligand, CD40-L, T-Cell Antigen Gp39, TNF-Related Activation Protein, TRAP, Tumor Necrosis Factor Ligand Superfamily Member 5, CD154, CD40LG, CD40L, TNFSF5, TRAP |
| Accession # |
P29965 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 200mM NaCl, 0.1mM EDTA, pH 7.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Biological Activity |
Recombinant CD40L is fully biologically active when compared to standards.
ED50 is 5-10 ng/ml as determined by the dose-dependent stimulation of IL-12 & IL-8 induction by PMB (Peripheral Mononuclear) cells. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTF CSNREASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVT DPSQVSHGTGFTSFGLLKL
|
| Background |
CD40 Ligand (CD40LG) is a type II transmembrane glycoprotein that belongs to the TNF superfamily. Like other TNF superfamily members, CD40LG exists as a trimer in membrane bound and soluble form, both of which are bioactive. CD40LG is a ligand for CD40; its ligation also initiates signal transduction in CD40LG expressing cells. CD40LG is a differentiation antigen that is expressed on the surface of T-cells. It stimulates B-cell proliferation and secretion of all immunoglobulin isotypes in the presence of cytokines. CD40LG has been shown to induce cytokine production and tumoricidal activity in peripheral blood monocytes. It also co-stimulates proliferation of activated T-cells and this is accompanied by the production of IFN-gamma, TNF-alpha, and IL2. |
