| Catalog# |
CF17 |
| Source |
E.coli |
| Description |
Recombinant Human T-Cell Receptor-Associated Transmembrane Adapter 1/TRAT1 is produced with our E. coli expression system. The target protein is expressed with sequence (Asn29-Asn186) of Human TRAT1 fused with a 6His tag at the C-terminus. |
| Names |
T-Cell Receptor-Associated Transmembrane Adapter 1, T-Cell Receptor-Interacting Molecule, TRIM, pp29/30, TRAT1, TCRIM, HSPC062 |
| Accession # |
Q6PIZ9 |
| Formulation |
Supplied as a 0.2 μm filtered solution of PBS, 10% Glycerol, pH 7.4 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
MNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNK MQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFS PESQAVEENIHDDPIRLFGLIRAKREPINLEHHHHHH
|
| Background |
T-Cell Receptor-Associated Transmembrane Adapter 1 (TRAT1) is a single-pass type III membrane protein. TRAT1 exists as a disulfide-linked homodimer and is strongly expressed in the thymus, and to a lesser extent in the spleen, lymph node, and peripheral blood lymphocytes. TRAT1 is phosphorylated on tyrosines by LCK or FYN upon TCR activation. Its function is to stabilizes the TCR (T-cell antigen receptor)/CD3 complex at the surface of T-cells. |
