Catalog# |
C507 |
Source |
HEK293 |
Description |
Recombinant Human Neurotrophic Tyrosine Kinase Receptor Type 2/NTRK2 produced by transfected human cells is a secreted protein with sequence (Cys32-His430) of Human NTRK2 fused with a polyhistidine tag at the C-terminus. |
Names |
BDNF/NT-3 Growth Factors Receptor, GP145-TrkB, Trk-B, Neurotrophic Tyrosine Kinase Receptor Type 2, TrkB Tyrosine Kinase, Tropomyosin-Related Kinase B, NTRK2, TRKB |
Accession # |
Q16620 |
Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
Amino Acid Sequence |
CPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITEIFIANQKRLEIINEDDVEAYVGLRNL TIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKT LQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEEGKSITLSCSVAGDPVP NMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITF LESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNN GDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPSTD VTDKTGREHVDHHHHHH
|
Background |
The TRK Family of Tyrosine Kinase Receptor consists of 3 members: TrkA, TrkB and TrkC. The three TRK family proteins have different ligand specificities. They connect to different neurotrophins, including NGF, BDNF, NT-3NT-4/5. TRKA binds NGF, TRKB binds BDNF and NT-3, TRKC binds NT-4/5. At the protein sequence level, human and rat TRKB have greater than 90% sequence identity and the proteins exbihit cross-species activity. TRKB is primarily expressed in the nervous system and it also expression in a wide variety of tissues with low levels. |