| Catalog# |
CD87 |
| Source |
Human Cells |
| Description |
Recombinant Human Tsukushin/TSKU is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr17-Leu353) of Human Tsukushin fused with a polyhistidine tag at the C-terminus. |
| Names |
Tsukushin,Tsukushi,E2-induced gene 4 protein，Leucine-rich repeat-containing protein 54，E2IG4, LRRC54, TSK |
| Accession # |
Q8WUA8 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS，pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
TRPCFPGCQCEVETFGLFDSFSLTRVDCSGLGPHIMPVPIPLDTAHLDLSSNRLEMVNESVLAGP GYTTLAGLDLSHNLLTSISPTAFSRLRYLESLDLSHNGLTALPAESFTSSPLSDVNLSHNQLREV SVSAFTTHSQGRALHVDLSHNLIHRLVPHPTRAGLPAPTIQSLNLAWNRLHAVPNLRDLPLRYLS LDGNPLAVIGPGAFAGLGGLTHLSLASLQRLPELAPSGFRELPGLQVLDLSGNPKLNWAGAEVFS GLSSLQELDLSGTNLVPLPEALLLHLPALQSVSVGQDVRCRRLVREGTYPRRPGSSPKVALHCVD TRDSAARGPTILVDHHHHHH
|
| Background |
TSKU is a secreted protein and contains 10 LRR (leucine-rich) repeats and 1 LRRNT domain. The alternative splicing of TSK RNA leads to the formation of twoisoforms (TSKA, originally designated as TSK, and TSKB) that differ in their C-terminal region .The crucial function for TSK in promoting formation of the primitive streak and Hensen'snode by positively regulating VG1 activity . In Xenopus embryos, TSK can block BMP function and induce a secondary dorsal axis,while it can dorsalize ventral mesoderm and induce neural tissue in embryonic explants.TSK directly binds VG1 in vitro, and that TSK and VG1functionally interact in axis formation, as shown by biological assays performed in chick and Xenopus embryos . |
