| Catalog# |
C183 |
| Source |
E.coli |
| Description |
Recombinant Human Ubiquitin-Conjugating Enzyme E2 A/UBE2A is produced by our E. coli expression system. The target protein is expressed with sequence (Met1-Cys152) of Human UBE2A fused with a GST tag and a His tag at the N-terminus. |
| Names |
Ubiquitin-Conjugating Enzyme E2 A, RAD6 Homolog A, HR6A, hHR6A, Ubiquitin Carrier Protein A, Ubiquitin-Protein Ligase A, UBE2A, RAD6A |
| Accession # |
P49459 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPRGSTAIGMKETAAAKFERQHM DSPDLGTGGGSGDDDDKSPMGSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEG TPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQ SLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWRDC
|
| Background |
Ubiquitin-Conjugating Enzyme E2 (UBE2A) is a member of the E2 Ubiquitin-Conjugating Enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2A catalyzes the covalent attachment of ubiquitin to other proteins. UBE2A is required for postreplication repair of UV-damaged DNA. UBE2A Interacts with RAD18 and WAC. |
