| Catalog# |
CF58 |
| Source |
E.coli |
| Description |
Recombinant Human Ubiquitin-Conjugating Enzyme E2 B/UBE2B is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Ser152) of Human UBE2B. |
| Names |
Ubiquitin-Conjugating Enzyme E2 B, RAD6 Homolog B, HR6B, hHR6B, Ubiquitin Carrier Protein B, Ubiquitin-Conjugating Enzyme E2-17 kDa, Ubiquitin-Protein Ligase B, UBE2B, RAD6B |
| Accession # |
P63146 |
| Formulation |
Supplied as a 0.2 μm filtered solution of 10mM HEPES, pH 7.5 |
| Shipping |
The product is shipped on dry ice/ice packs. |
| Storage |
Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
GSHMSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEE YPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAA QLYQENKREYEKRVSAIVEQSWNDS
|
| Background |
Ubiquitin-Conjugating Enzyme E2 B (UBE2B) belongs to the ubiquitin-conjugating enzyme family. UBE2B can catalyze the covalent attachment of ubiquitin to other proteins, and is essential for the multi-ubiquitination and degradation of N-end rule substrates. UBE2B is indispensability for postreplication repair of UV-damaged DNA and may be involved in neurite outgrowth.Additionally, UBE2B may have a role in sepsis-induced muscle protein proteolysis and cancer-induced cachexia. |
