| Catalog# |
C190 |
| Source |
E.coli |
| Description |
Recombinant Human Uteroglobin-Related Protein 1/UGRP1 is produced by our E. coli expression system. The target protein is expressed with sequence (Phe22-Val93) of Human UGRP1. |
| Names |
Secretoglobin Family 3A Member 2, Pneumo Secretory Protein 1, PnSP-1, Uteroglobin-Related Protein 1, SCGB3A2, PNSP1, UGRP1 |
| Accession # |
Q96PL1 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLL EALSHLV
|
| Background |
Uteroglobin-Related Protein 1 (UGRP1) belongs to the secretoglobin family which has been suggested to play a role in lung inflammation and allergic diseases. UGRP1 is a 17 kDa secreted homodimeric protein that shows amino acid sequence similarity with uteroglobin. UGRP1 is expressed predominantly in the lung and low levels of expression are detected in the thyroid. Expression of UGRP1 in lung epithelial cells is enhanced by IL-10 and decreased through the activities of IL-9 and IL-5. UGRP1 interacts with the macrophage scavenger receptor with collagenous structure which is expressed by alveolar macrophages in the lung. It have suggested that UGRP1 may be involved in inflammation and pathogen clearance in the lung by binding to its receptor. |
