| Catalog# |
C498 |
| Source |
Human Cells |
| Description |
Recombinant Human Vascular Endothelial Growth Factor D/VEGFD produced by our mammalian expression system in human cells is expressed with sequence (Phe93-Ser201) of Human VEGFD. |
| Names |
Vascular Endothelial Growth Factor D, VEGF-D, c-Fos-Induced Growth Factor, FIGF, VEGFD |
| Accession # |
O43915 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/µg (1 IEU/µg). |
| Amino Acid Sequence |
FYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTS TSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSHHHHHH
|
| Background |
Vascular endothelial growth factor D (VEGF-D), also known as c-fos-induced growth factor (FIGF), is a secreted glycoprotein of the VEGF/PDGF family. VEGFs regulate angiogenesis and lymphangiogenesis during development and tumor growth, and are characterized by eight conserved cysteine residues that form a cystine knot structure.Mouse and human VEGF-D are ligands for VEGF Receptor 3 (VEGF R3, also called Flt4) that are active across species and show enhanced affinity when processed . Processed human VEGF-D is also a ligand for VEGF R2, also called Flk1 or KDR. VEGF R3 is strongly expressed in lymphatic endothelial cells and is essential for regulation of the growth and differentiation of lymphatic endothelium. While VEGF-C is the critical ligand for VEGF R3 during embryonic lymphatic development, VEGF-D is most active in neonatal lymphatic maturation and bone growth. Both promote tumor lymphangiogenesis. Consonant with their activity on VEGF receptors, binding of VEGF-C and VEGF-D. |
