| Catalog# |
C395 |
| Source |
HEK293 |
| Description |
Recombinant Human Vitronectin/VTN is produced by our mammalian expression system. The target protein is expressed with sequence (Asp20-Leu478) of Human VTN fused with a polyhistidine tag at the C-terminus. |
| Names |
Vitronectin, VN, S-Protein, Serum-Spreading Factor, V75, VTN |
| Accession # |
P04004 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 8.0 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEK NNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQP PAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRIN CQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQY WEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPG QVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRAMWLSLFSSEE SNLGANNYDDYRMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPA PGHLVDHHHHHH
|
| Background |
Human Vitronectin/VTN is a cell adhesion and spreading factor. It can be found in the blood and the extracellular matrix (ECM). Vitronectin interacts with glycosaminoglycans and proteoglycans. The multimeric Vitronectin can efficiently bind to and incorporate into the ECM; Vitronectin can support cell adhesion through binding to various integrins and other proteoglycans. Vitronectin can be recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecular. It can as a inhibitor of the membrane-damaging effect of the terminal cytolytic complement pathway. Vitronectin contains an endogenous cleavage site, plus cleavage sites for elastase, thrombin, and plasmin. |
