| Catalog# |
C548 |
| Source |
HEK293 |
| Description |
Recombinant Human V-Set and Immunoglobulin Domain-Containing Protein 2/VSIG2 produced by transfected human cells is a secreted protein with sequence (Val24-Ala243) of Human VSIG2 fused with a polyhistidine tag at the C-terminus. |
| Names |
V-Set and Immunoglobulin Domain-Containing Protein 2, Cortical Thymocyte-Like Protein, CT-Like Protein, VSIG2, CTH, CTXL |
| Accession # |
Q96IQ7 |
| Formulation |
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 1X PBS.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Endotoxin |
Less than 0.1 ng/μg (1 IEU/μg). |
| Amino Acid Sequence |
VEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISESHPILYFTNGHLYPTGSK SKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLTVLVPPSNPLCSQS GQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLTSSGTYRCV ATNQMGSASCELTLSVTEPSQGRVAVDHHHHHH
|
| Background |
V-Set and Immunoglobulin Domain-Containing Protein 2 (VSIG2) is presumably a 50-60 kDa single-pass type I transmembrane (glyco)protein which contains one Ig-like C2-type (immunoglobulin-like) domain and one Ig-like V-type (immunoglobulin-like) domain. VSIG2 is highly expressed in the stomach, colon, prostate, trachea and thyroid glands and weakly in bladder and lung. V-set domains are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains, in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86, in myelin membrane adhesion molecules, in junction adhesion molecules (JAM), in tyrosine-protein kinase receptors, and in the programmed cell death protein 1 (PD1). It shows expression in stomach and prostate by Northern blot, and likely participates in cell adhesion. Human VSIG2 precursor is 327 amino acids in length. |
