| Catalogue Number |
CYT-394 |
| Synonyms |
Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta. |
| Introduction |
Interleukin-1b is produced by activated macrophages, IL-1B stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1B proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. |
| Description |
Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa. |
| The IL-1b is purified by proprietary chromatographic techniques. |
| Source |
Escherichia Coli. |
| Physical Appearance |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation |
The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4. |
| Solubility |
It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Stability |
Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C. |
| For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). |
| Please prevent freeze-thaw cycles. |
| Purity |
Greater than 97.0% as determined by SDS-PAGE. |
| Amino acid sequence |
MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSF |
| VQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKK |
| KMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRD |
| IVDFTMEPVSS. |
| Biological Activity |
The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10,000,000 units/mg. |
| Protein content |
Protein quantitation was carried out by two independent methods: |
| 1. UV spectroscopy at 280 nm using the absorbency value of 0.558 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). |
| 2. Analysis by RP-HPLC, using a standard solution of IL-1b as a Reference Standard. |
| Usage |
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
| Related Products |
» IL 1 Beta Antibody |
| » IL 1 Beta Antibody, Biotin |
| » IL 1 Beta Antibody, FITC |
| » IL 1 beta Human |
| » IL 1 beta Human, HEK |
| » IL 1 beta Human, His |
| » IL 1 beta Monkey |
| » IL 1 beta Mouse |
| » IL 1 beta Mouse, His |
| » IL 1 beta Porcine |
